PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000263595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 327aa    MW: 37307.6 Da    PI: 7.9404
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000263595genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+lv+ ++ +G g+W+++++  g+ R++k+c++rw++yl
    MDP0000263595 14 RGLWSPEEDEKLVRHITTYGHGCWRKVPEQAGLQRCGKSCRLRWLNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding49.78.5e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+eE++l+++++   G++ W+ Ia++++ gRt++++k++w+++
    MDP0000263595  67 RGGFTPEEEKLIIRLHGVVGNR-WTHIAKCLP-GRTDNEIKNYWNSW 111
                      788*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25664IPR009057Homeodomain-like
PROSITE profilePS5129416.967961IPR017930Myb domain
SuperFamilySSF466898.61E-3012108IPR009057Homeodomain-like
SMARTSM007171.9E-131363IPR001005SANT/Myb domain
PfamPF002492.3E-151461IPR001005SANT/Myb domain
CDDcd001672.35E-111761No hitNo description
PROSITE profilePS5129423.53662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.4E-2565116IPR009057Homeodomain-like
SMARTSM007175.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1467111IPR001005SANT/Myb domain
CDDcd001674.03E-1270112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGHHYCCKQR KVKRGLWSPE EDEKLVRHIT TYGHGCWRKV PEQAGLQRCG KSCRLRWLNY  60
LRPDIKRGGF TPEEEKLIIR LHGVVGNRWT HIAKCLPGRT DNEIKNYWNS WIKKKLEKPS  120
SPPTTSPSNL DHQHNYQMGC SYPNQQVFMN QNFITKPTAA RDQILYPSPY PLFMFDTVSL  180
DETTNNNTNV RSADQHFPLA RSNNSNNNGT WILDQQQQHQ VQAFPSSTAP FTNNNMDAQF  240
LPSLLGSSIG NNNMVPVEVG SCSNIDDEEE ISMECLQSTT QELNALVHSR QAQQCSSNNF  300
HFWDSVEGPS SSNLRSANTL SSFPSYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363433.10.0PREDICTED: transcription factor MYB113-like
TrEMBLM5WCE00.0M5WCE0_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s13190.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.15e-74myb domain protein 103